PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0369s0230.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MYB
Protein Properties Length: 560aa    MW: 61459.2 Da    PI: 4.9045
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0369s0230.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.6e-174087148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
         Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                            +g+WT  Ed +l+++vk++G g+W+++ ++ g+ R++k+c++rw ++l
  SapurV1A.0369s0230.1.p 40 KGPWTSAEDAILIEYVKKHGEGNWNAVQKHSGLFRCGKSCRLRWANHL 87
                            79******************************************9986 PP

2Myb_DNA-binding50.74.2e-1693136146
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
         Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                             +g++T+eE++l++++++ +G++ W+  a++++ gRt++++k++w++
  SapurV1A.0369s0230.1.p  93 KGAFTQEEEQLIIQLHATMGNK-WAQMAAHLP-GRTDNEIKNYWNT 136
                             799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.5473587IPR017930Myb domain
SuperFamilySSF466891.24E-3038134IPR009057Homeodomain-like
SMARTSM007171.2E-153989IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-244194IPR009057Homeodomain-like
CDDcd001674.18E-124287No hitNo description
PfamPF139214.3E-1643103No hitNo description
PROSITE profilePS5129425.6288142IPR017930Myb domain
SMARTSM007177.9E-1792140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-2695141IPR009057Homeodomain-like
CDDcd001675.88E-1295136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MSHAGSESED GMLSNNQIES PLGEEGNYGG SANGGVALKK GPWTSAEDAI LIEYVKKHGE  60
GNWNAVQKHS GLFRCGKSCR LRWANHLRPN LKKGAFTQEE EQLIIQLHAT MGNKWAQMAA  120
HLPGRTDNEI KNYWNTRIKR RQRAGLPLYP PEVSLQAMQE SQRCLNNDRI ESENKSQHDT  180
LLSKNYGIPN IMFDNLKANQ SILPYVPELR DITASSMLMK GVSSSQYGSF MSPIMHRQKR  240
LREETTLLSS FSGGMKNEFH LFDQFQDVNK AAQSFGLPFP FDPDSTTKNP EFFGENQGSH  300
TLANGNFSAS KPTAEAVKLE LPSLQYSETD LGGRGPSCSP SPLIKSVDTF IQSPPTGTVE  360
SVCPSPRNSG LLDALLHEAK TLSSAKNQLS EKSSNSSTIT PGDNADSFAL NICEKEWEDY  420
GHPISPLGHT ATSLFSECTP ISANESSLEE SPSAETFTEA NVKSEPVDQI WTADRENESY  480
TWLDITFPDA LLDSDWLEHD SACGKGQVIV NDAMGTLLGD DLGNEYKQMA AGASVSHGWG  540
HSSCSWDSMP AVYQMYELP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-32381415107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002297703.20.0hypothetical protein POPTR_0001s07330g
TrEMBLB9GLT00.0B9GLT0_POPTR; Uncharacterized protein
STRINGPOPTR_0001s07330.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.11e-136myb domain protein 65